Lineage for d1k3td1 (1k3t D:1-164,D:334-359)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175673Species Trypanosoma cruzi [TaxId:5693] [75104] (1 PDB entry)
  8. 175677Domain d1k3td1: 1k3t D:1-164,D:334-359 [72028]
    Other proteins in same PDB: d1k3ta2, d1k3tb2, d1k3tc2, d1k3td2

Details for d1k3td1

PDB Entry: 1k3t (more details), 1.95 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi Complexed with Chalepin, a Coumarin Derivative Inhibitor

SCOP Domain Sequences for d1k3td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3td1 c.2.1.3 (D:1-164,D:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

SCOP Domain Coordinates for d1k3td1:

Click to download the PDB-style file with coordinates for d1k3td1.
(The format of our PDB-style files is described here.)

Timeline for d1k3td1: