Lineage for d1k3ta2 (1k3t A:165-333)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1659008Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1659009Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1659010Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1659101Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1659299Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)
  8. 1659304Domain d1k3ta2: 1k3t A:165-333 [72023]
    Other proteins in same PDB: d1k3ta1, d1k3tb1, d1k3tc1, d1k3td1
    complexed with brz

Details for d1k3ta2

PDB Entry: 1k3t (more details), 1.95 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi Complexed with Chalepin, a Coumarin Derivative Inhibitor
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1k3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOPe Domain Coordinates for d1k3ta2:

Click to download the PDB-style file with coordinates for d1k3ta2.
(The format of our PDB-style files is described here.)

Timeline for d1k3ta2: