![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (3 families) ![]() known or predicted SAM-dependent methytransferases; all known members have dimeric structures |
![]() | Family c.116.1.2: Hypothetical protein MTH1 (MT0001), dimerisation domain [75221] (1 protein) contains extra strand (3) in the parallel beta-sheet, order 321546; interrupted by an insert OB-fold domain |
![]() | Protein Hypothetical protein MTH1 (MT0001), dimerisation domain [75222] (1 species) |
![]() | Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [75223] (1 PDB entry) |
![]() | Domain d1k3rb2: 1k3r B:1-92,B:164-264 [72021] Other proteins in same PDB: d1k3ra1, d1k3rb1 structural genomics protein |
PDB Entry: 1k3r (more details), 2.3 Å
SCOP Domain Sequences for d1k3rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3rb2 c.116.1.2 (B:1-92,B:164-264) Hypothetical protein MTH1 (MT0001), dimerisation domain {Archaeon Methanobacterium thermoautotrophicum} mnrvdlslfipdsltaetgdlkiktykvvliaraasifgvkriviyhddadgearfirdi ltymdtpqylrrkvfpimrelkhvgilpplrtXgyevldtrrnlaeslktvgadvvvats rnaspitsildevktrmrgareaailfggpykglpeidadiwvntlpgqctetvrteeav latlsvfnmltqid
Timeline for d1k3rb2: