SCOP 1.61: Domain d1k3rb2: 1k3r B:1-92,B:164-264

Lineage for d1k3rb2 (1k3r B:1-92,B:164-264)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)

4. Superfamily c.116.1: alpha/beta knot [75217] (2 families)

5. Family c.116.1.2: Hypothetical protein MTH1 (MT0001), dimerisation domain [75221] (1 protein)

6. Protein Hypothetical protein MTH1 (MT0001), dimerisation domain [75222] (1 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [75223] (1 PDB entry)

8. Domain d1k3rb2: 1k3r B:1-92,B:164-264 [72021]
   Other proteins in same PDB: d1k3ra1, d1k3rb1

Details for d1k3rb2

PDB Entry: 1k3r, 2.3 Å

PDB Description: Crystal Structure of the Methyltransferase with a Knot from Methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1k3rb2:

Sequence; same for both SEQRES and ATOM records:

>d1k3rb2 c.116.1.2 (B:1-92,B:164-264) Hypothetical protein MTH1 (MT0001), dimerisation domain {Archaeon Methanobacterium thermoautotrophicum}
mnrvdlslfipdsltaetgdlkiktykvvliaraasifgvkriviyhddadgearfirdi
ltymdtpqylrrkvfpimrelkhvgilpplrtXgyevldtrrnlaeslktvgadvvvats
rnaspitsildevktrmrgareaailfggpykglpeidadiwvntlpgqctetvrteeav
latlsvfnmltqid

Timeline for d1k3rb2:

• d1k3rb2 is new in SCOP 1.61
  
• d1k3rb2 appears in SCOP 1.63
  
• d1k3rb2 appears in the current release, SCOPe 2.08