SCOPe 2.08: Domain d1k3ra1: 1k3r A:93-163

Lineage for d1k3ra1 (1k3r A:93-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.10: Hypothetical protein MTH1 (MT0001), insert domain [74955] (1 protein)

6. Protein Hypothetical protein MTH1 (MT0001), insert domain [74956] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [74957] (1 PDB entry)

8. Domain d1k3ra1: 1k3r A:93-163 [72018]
   Other proteins in same PDB: d1k3ra2, d1k3rb2

Details for d1k3ra1

PDB Entry: 1k3r, 2.3 Å

PDB Description: Crystal Structure of the Methyltransferase with a Knot from Methanobacterium thermoautotrophicum

PDB Compounds: (A:) conserved protein MT0001

SCOPe Domain Sequences for d1k3ra1:

Sequence; same for both SEQRES and ATOM records:

>d1k3ra1 b.40.4.10 (A:93-163) Hypothetical protein MTH1 (MT0001), insert domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
phhptgkpvtgeyrqgltvkrvkkgtlvdigadklalcrekltvnrimsfrvvrlgkeil
iepdepedryw

Timeline for d1k3ra1:

• d1k3ra1 first appeared in SCOP 1.61
  
• d1k3ra1 appears in SCOPe 2.07