SCOPe 2.03: Domain d1k3ka_: 1k3k A:

Lineage for d1k3ka_ (1k3k A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 homolog [75637] (1 species)

7. Species Kaposi's sarcoma-associated herpesvirus [TaxId:37296] [75638] (1 PDB entry)

8. Domain d1k3ka_: 1k3k A: [72017]

Details for d1k3ka_

PDB Entry: 1k3k

PDB Description: solution structure of a bcl-2 homolog from kaposi's sarcoma virus

PDB Compounds: (A:) functional anti-apoptotic factor vBCL-2 homolog

SCOPe Domain Sequences for d1k3ka_:

Sequence; same for both SEQRES and ATOM records:

>d1k3ka_ f.1.4.1 (A:) Bcl-2 homolog {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]}
mdedvlpgevlaiegifmacglnepeylyhpllspiklyitglmrdkeslfeamlanvrf
hsttgidqlglsmlqvsgdgnmnwgralailtfgsfvaqklsnephlrdfalavlpayay
eaigpqwfrarggwrglkayctqvlt

Timeline for d1k3ka_:

• d1k3ka_ first appeared in SCOP 1.61
  
• d1k3ka_ appears in SCOPe 2.02
  
• d1k3ka_ appears in SCOPe 2.04
  
• d1k3ka_ appears in the current release, SCOPe 2.08