Lineage for d1k2pb_ (1k2p B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929376Protein Bruton's tyrosine kinase (Btk) [75564] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1929377Species Human (Homo sapiens) [TaxId:9606] [75565] (1 PDB entry)
  8. 1929379Domain d1k2pb_: 1k2p B: [72013]

Details for d1k2pb_

PDB Entry: 1k2p (more details), 2.1 Å

PDB Description: Crystal structure of Bruton's tyrosine kinase domain
PDB Compounds: (B:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d1k2pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2pb_ d.144.1.7 (B:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}
idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
kaderptfkillsnildv

SCOPe Domain Coordinates for d1k2pb_:

Click to download the PDB-style file with coordinates for d1k2pb_.
(The format of our PDB-style files is described here.)

Timeline for d1k2pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k2pa_