![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Bruton's tyrosine kinase (Btk) [75564] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75565] (1 PDB entry) |
![]() | Domain d1k2pb_: 1k2p B: [72013] |
PDB Entry: 1k2p (more details), 2.1 Å
SCOP Domain Sequences for d1k2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2pb_ d.144.1.7 (B:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe kaderptfkillsnildv
Timeline for d1k2pb_: