Lineage for d1k2pa_ (1k2p A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197388Family d.144.1.2: Tyrosine kinase [56150] (13 proteins)
  6. 197395Protein Bruton's tyrosine kinase (Btk) [75564] (1 species)
  7. 197396Species Human (Homo sapiens) [TaxId:9606] [75565] (1 PDB entry)
  8. 197397Domain d1k2pa_: 1k2p A: [72012]

Details for d1k2pa_

PDB Entry: 1k2p (more details), 2.1 Å

PDB Description: Crystal structure of Bruton's tyrosine kinase domain
PDB Compounds: (A:)

SCOP Domain Sequences for d1k2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2pa_ d.144.1.2 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens)}
idpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshek
lvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskq
flhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfss
ksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhe
kaderptfkillsnildv

SCOP Domain Coordinates for d1k2pa_:

Click to download the PDB-style file with coordinates for d1k2pa_.
(The format of our PDB-style files is described here.)

Timeline for d1k2pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k2pb_