SCOP 1.73: Domain d1k2eb_: 1k2e B:

Lineage for d1k2eb_ (1k2e B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.1: MutT-like [55812] (16 proteins)

6. Protein Hypothetical protein PAE3301 [75527] (1 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)

8. Domain d1k2eb_: 1k2e B: [72011]
   complexed with acy, cry, ni, so4; mutant

Details for d1k2eb_

PDB Entry: 1k2e, 1.8 Å

PDB Description: crystal structure of a nudix protein from Pyrobaculum aerophilum

PDB Compounds: (B:) Nudix homolog

SCOP Domain Sequences for d1k2eb_:

Sequence; same for both SEQRES and ATOM records:

>d1k2eb_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaale

Timeline for d1k2eb_:

• d1k2eb_ first appeared in SCOP 1.61
  
• d1k2eb_ appears in SCOP 1.71
  
• d1k2eb_ appears in SCOP 1.75
  
• d1k2eb_ appears in the current release, SCOPe 2.08, called d1k2eb1