Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (2 families) |
Family d.113.1.1: MutT-like [55812] (5 proteins) |
Protein Hypothetical protein PAE3301 [75527] (1 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) |
Domain d1k2eb_: 1k2e B: [72011] complexed with acy, cry, ni, so4; mutant |
PDB Entry: 1k2e (more details), 1.8 Å
SCOP Domain Sequences for d1k2eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2eb_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum} mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie tfpnvrkvvslalstlyrlgkisklaaale
Timeline for d1k2eb_: