Lineage for d1k2ea1 (1k2e A:1-143)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211447Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2211590Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 2211591Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 2211592Domain d1k2ea1: 1k2e A:1-143 [72010]
    Other proteins in same PDB: d1k2ea2, d1k2eb2
    complexed with acy, gol, ni, so4

Details for d1k2ea1

PDB Entry: 1k2e (more details), 1.8 Å

PDB Description: crystal structure of a nudix protein from Pyrobaculum aerophilum
PDB Compounds: (A:) Nudix homolog

SCOPe Domain Sequences for d1k2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2ea1 d.113.1.1 (A:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkis

SCOPe Domain Coordinates for d1k2ea1:

Click to download the PDB-style file with coordinates for d1k2ea1.
(The format of our PDB-style files is described here.)

Timeline for d1k2ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k2ea2