Lineage for d1k2ea_ (1k2e A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 333446Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 333447Family d.113.1.1: MutT-like [55812] (5 proteins)
  6. 333470Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 333471Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 333472Domain d1k2ea_: 1k2e A: [72010]

Details for d1k2ea_

PDB Entry: 1k2e (more details), 1.8 Å

PDB Description: crystal structure of a nudix protein from Pyrobaculum aerophilum

SCOP Domain Sequences for d1k2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaalehh

SCOP Domain Coordinates for d1k2ea_:

Click to download the PDB-style file with coordinates for d1k2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1k2ea_: