![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Hypothetical protein PAE3301 [75527] (1 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) |
![]() | Domain d1k2ea1: 1k2e A:1-143 [72010] Other proteins in same PDB: d1k2ea2, d1k2eb2 complexed with acy, gol, ni, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1k2e (more details), 1.8 Å
SCOPe Domain Sequences for d1k2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2ea1 d.113.1.1 (A:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]} mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie tfpnvrkvvslalstlyrlgkis
Timeline for d1k2ea1: