Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (1 family) can be classified as disulphide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64206] (6 PDB entries) |
Domain d1k2aa_: 1k2a A: [72005] complexed with so4 |
PDB Entry: 1k2a (more details), 1 Å
SCOP Domain Sequences for d1k2aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k2aa_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens)} hvkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnp nmtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrr dppqypvvpvhldrii
Timeline for d1k2aa_: