Lineage for d1k2aa_ (1k2a A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324599Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 324600Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 324601Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 324643Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 324644Species Human (Homo sapiens) [TaxId:9606] [64206] (6 PDB entries)
  8. 324646Domain d1k2aa_: 1k2a A: [72005]
    complexed with so4

Details for d1k2aa_

PDB Entry: 1k2a (more details), 1 Å

PDB Description: Modified Form of Eosinophil-derived Neurotoxin

SCOP Domain Sequences for d1k2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k2aa_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens)}
hvkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnp
nmtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrr
dppqypvvpvhldrii

SCOP Domain Coordinates for d1k2aa_:

Click to download the PDB-style file with coordinates for d1k2aa_.
(The format of our PDB-style files is described here.)

Timeline for d1k2aa_: