Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein Hypothetical protein PAE3301 [75527] (1 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) |
Domain d1k26b1: 1k26 B:1-143 [72004] Other proteins in same PDB: d1k26a2, d1k26b2 complexed with acy, gol, ir3, ni, so4 |
PDB Entry: 1k26 (more details), 1.85 Å
SCOPe Domain Sequences for d1k26b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k26b1 d.113.1.1 (B:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]} mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie tfpnvrkvvslalstlyrlgkis
Timeline for d1k26b1: