Lineage for d1k26b_ (1k26 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 731931Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 732019Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 732020Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 732024Domain d1k26b_: 1k26 B: [72004]
    complexed with acy, cry, ir3, ni, so4; mutant

Details for d1k26b_

PDB Entry: 1k26 (more details), 1.85 Å

PDB Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method
PDB Compounds: (B:) Nudix homolog

SCOP Domain Sequences for d1k26b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k26b_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaa

SCOP Domain Coordinates for d1k26b_:

Click to download the PDB-style file with coordinates for d1k26b_.
(The format of our PDB-style files is described here.)

Timeline for d1k26b_: