SCOP 1.71: Domain d1k26b_: 1k26 B:

Lineage for d1k26b_ (1k26 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.1: MutT-like [55812] (10 proteins)

6. Protein Hypothetical protein PAE3301 [75527] (1 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)

8. Domain d1k26b_: 1k26 B: [72004]
   complexed with acy, cry, ir3, ni, so4; mutant

Details for d1k26b_

PDB Entry: 1k26, 1.85 Å

PDB Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method

SCOP Domain Sequences for d1k26b_:

Sequence; same for both SEQRES and ATOM records:

>d1k26b_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaa

Timeline for d1k26b_:

• d1k26b_ first appeared in SCOP 1.61
  
• d1k26b_ appears in SCOP 1.69
  
• d1k26b_ appears in SCOP 1.73
  
• d1k26b_ appears in the current release, SCOPe 2.08, called d1k26b1