SCOPe 2.02: Domain d1k26a_: 1k26 A:

Lineage for d1k26a_ (1k26 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein PAE3301 [75527] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)

8. Domain d1k26a_: 1k26 A: [72003]
   complexed with acy, gol, ir3, ni, so4

Details for d1k26a_

PDB Entry: 1k26, 1.85 Å

PDB Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method

PDB Compounds: (A:) Nudix homolog

SCOPe Domain Sequences for d1k26a_:

Sequence; same for both SEQRES and ATOM records:

>d1k26a_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaale

Timeline for d1k26a_:

• d1k26a_ first appeared in SCOP 1.61
  
• d1k26a_ appears in SCOPe 2.01
  
• d1k26a_ appears in SCOPe 2.03
  
• d1k26a_ appears in the current release, SCOPe 2.08, called d1k26a1