Lineage for d1k26a_ (1k26 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871097Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 871186Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 871187Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 871190Domain d1k26a_: 1k26 A: [72003]

Details for d1k26a_

PDB Entry: 1k26 (more details), 1.85 Å

PDB Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method
PDB Compounds: (A:) Nudix homolog

SCOP Domain Sequences for d1k26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k26a_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaale

SCOP Domain Coordinates for d1k26a_:

Click to download the PDB-style file with coordinates for d1k26a_.
(The format of our PDB-style files is described here.)

Timeline for d1k26a_: