Lineage for d1k26a_ (1k26 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.113: Nudix [55810] (1 superfamily) Superfamily d.113.1: Nudix [55811] (2 families) 
Family d.113.1.1: MutT-like [55812] (4 proteins) 
Protein Hypothetical protein PAE3301 [75527] (1 species) Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) 
Domain d1k26a_: 1k26 A: [72003]
Details for d1k26a_
PDB Entry: 1k26 (more details), 1.85 Å
PDB Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method
SCOP Domain Sequences for d1k26a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k26a_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaale
SCOP Domain Coordinates for d1k26a_:
Click to download the PDB-style file with coordinates for d1k26a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k26a_:
- d1k26a_ is new in SCOP 1.61
- d1k26a_ appears in SCOP 1.63
- d1k26a_ appears in the current release, SCOPe 2.08, called d1k26a1
View in 3D
