Lineage for d1k1dh2 (1k1d H:53-384)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683751Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
  6. 683752Protein D-hydantoinase [75074] (4 species)
  7. 683756Species Bacillus stearothermophilus [TaxId:1422] [75076] (1 PDB entry)
  8. 683764Domain d1k1dh2: 1k1d H:53-384 [71994]
    Other proteins in same PDB: d1k1da1, d1k1db1, d1k1dc1, d1k1dd1, d1k1de1, d1k1df1, d1k1dg1, d1k1dh1
    complexed with kcx, zn

Details for d1k1dh2

PDB Entry: 1k1d (more details), 3.01 Å

PDB Description: Crystal structure of D-hydantoinase
PDB Compounds: (H:) D-hydantoinase

SCOP Domain Sequences for d1k1dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1dh2 c.1.9.6 (H:53-384) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]}
ggidphthldmplggtvtkddfesgtiaaafggtttiidfcltnkgeplkkaietwhnka
ngkavidygfhlmiseitddvleelpkvleeegitslkvfmayknvfqaddgtlyctlla
akelgalvmvhaengdvidyltkkaladgntdpiyhaltrppelegeatgracqltelag
sqlyvvhvtcaqavekiaearnkgldvwgetcpqylvldqsylekpnfegakyvwspplr
ekwhqevlwnalkngqlqtlgsdqcsfdfkgqkelgrgdftkipnggpiiedrvsilfse
gvkkgritlnqfvdivstriaklfglfpkkgt

SCOP Domain Coordinates for d1k1dh2:

Click to download the PDB-style file with coordinates for d1k1dh2.
(The format of our PDB-style files is described here.)

Timeline for d1k1dh2: