![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
![]() | Protein D-hydantoinase [75045] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [75047] (1 PDB entry) |
![]() | Domain d1k1dh1: 1k1d H:1-52,H:385-460 [71993] Other proteins in same PDB: d1k1da2, d1k1db2, d1k1dc2, d1k1dd2, d1k1de2, d1k1df2, d1k1dg2, d1k1dh2 complexed with zn |
PDB Entry: 1k1d (more details), 3.01 Å
SCOPe Domain Sequences for d1k1dh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1dh1 b.92.1.3 (H:1-52,H:385-460) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]} mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpXivvgsda dlvifdpniervisaethhmavdynafegmkvtgepvsvlcrgefvvrdkqfvgkpgygq ylkrakygt
Timeline for d1k1dh1: