SCOPe 2.05: Domain d1k1dg1: 1k1d G:1-52,G:385-460

Lineage for d1k1dg1 (1k1d G:1-52,G:385-460)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)

6. Protein D-hydantoinase [75045] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75047] (1 PDB entry)

8. Domain d1k1dg1: 1k1d G:1-52,G:385-460 [71991]
   Other proteins in same PDB: d1k1da2, d1k1db2, d1k1dc2, d1k1dd2, d1k1de2, d1k1df2, d1k1dg2, d1k1dh2
   complexed with zn

Details for d1k1dg1

PDB Entry: 1k1d, 3.01 Å

PDB Description: Crystal structure of D-hydantoinase

PDB Compounds: (G:) D-hydantoinase

SCOPe Domain Sequences for d1k1dg1:

Sequence; same for both SEQRES and ATOM records:

>d1k1dg1 b.92.1.3 (G:1-52,G:385-460) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]}
mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpXivvgsda
dlvifdpniervisaethhmavdynafegmkvtgepvsvlcrgefvvrdkqfvgkpgygq
ylkrakygt

Timeline for d1k1dg1:

• d1k1dg1 first appeared in SCOP 1.61
  
• d1k1dg1 appears in SCOPe 2.04
  
• d1k1dg1 appears in SCOPe 2.06
  
• d1k1dg1 appears in the current release, SCOPe 2.08