Lineage for d1k1dc2 (1k1d C:53-384)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173878Superfamily c.1.9: Metallo-dependent hydrolases [51556] (8 families) (S)
  5. 173966Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (2 proteins)
  6. 173967Protein D-hydantoinase [75074] (2 species)
  7. 173968Species Bacillus stearothermophilus [TaxId:1422] [75076] (1 PDB entry)
  8. 173971Domain d1k1dc2: 1k1d C:53-384 [71984]
    Other proteins in same PDB: d1k1da1, d1k1db1, d1k1dc1, d1k1dd1, d1k1de1, d1k1df1, d1k1dg1, d1k1dh1

Details for d1k1dc2

PDB Entry: 1k1d (more details), 3.01 Å

PDB Description: Crystal structure of D-hydantoinase

SCOP Domain Sequences for d1k1dc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1dc2 c.1.9.6 (C:53-384) D-hydantoinase {Bacillus stearothermophilus}
ggidphthldmplggtvtkddfesgtiaaafggtttiidfcltnkgeplkkaietwhnka
ngkavidygfhlmiseitddvleelpkvleeegitslkvfmayknvfqaddgtlyctlla
akelgalvmvhaengdvidyltkkaladgntdpiyhaltrppelegeatgracqltelag
sqlyvvhvtcaqavekiaearnkgldvwgetcpqylvldqsylekpnfegakyvwspplr
ekwhqevlwnalkngqlqtlgsdqcsfdfkgqkelgrgdftkipnggpiiedrvsilfse
gvkkgritlnqfvdivstriaklfglfpkkgt

SCOP Domain Coordinates for d1k1dc2:

Click to download the PDB-style file with coordinates for d1k1dc2.
(The format of our PDB-style files is described here.)

Timeline for d1k1dc2: