Lineage for d1k1dc1 (1k1d C:1-52,C:385-460)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811595Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 811596Protein D-hydantoinase [75045] (4 species)
  7. 811600Species Bacillus stearothermophilus [TaxId:1422] [75047] (1 PDB entry)
  8. 811603Domain d1k1dc1: 1k1d C:1-52,C:385-460 [71983]
    Other proteins in same PDB: d1k1da2, d1k1db2, d1k1dc2, d1k1dd2, d1k1de2, d1k1df2, d1k1dg2, d1k1dh2

Details for d1k1dc1

PDB Entry: 1k1d (more details), 3.01 Å

PDB Description: Crystal structure of D-hydantoinase
PDB Compounds: (C:) D-hydantoinase

SCOP Domain Sequences for d1k1dc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1dc1 b.92.1.3 (C:1-52,C:385-460) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]}
mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpXivvgsda
dlvifdpniervisaethhmavdynafegmkvtgepvsvlcrgefvvrdkqfvgkpgygq
ylkrakygt

SCOP Domain Coordinates for d1k1dc1:

Click to download the PDB-style file with coordinates for d1k1dc1.
(The format of our PDB-style files is described here.)

Timeline for d1k1dc1: