Lineage for d1k1db1 (1k1d B:1-52,B:385-460)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172428Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
  4. 172429Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (3 families) (S)
  5. 172472Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (2 proteins)
  6. 172473Protein D-hydantoinase [75045] (2 species)
  7. 172474Species Bacillus stearothermophilus [TaxId:1422] [75047] (1 PDB entry)
  8. 172476Domain d1k1db1: 1k1d B:1-52,B:385-460 [71981]
    Other proteins in same PDB: d1k1da2, d1k1db2, d1k1dc2, d1k1dd2, d1k1de2, d1k1df2, d1k1dg2, d1k1dh2

Details for d1k1db1

PDB Entry: 1k1d (more details), 3.01 Å

PDB Description: Crystal structure of D-hydantoinase

SCOP Domain Sequences for d1k1db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1db1 b.92.1.3 (B:1-52,B:385-460) D-hydantoinase {Bacillus stearothermophilus}
mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpXivvgsda
dlvifdpniervisaethhmavdynafegmkvtgepvsvlcrgefvvrdkqfvgkpgygq
ylkrakygt

SCOP Domain Coordinates for d1k1db1:

Click to download the PDB-style file with coordinates for d1k1db1.
(The format of our PDB-style files is described here.)

Timeline for d1k1db1: