| Class b: All beta proteins [48724] (111 folds) |
| Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (3 families) ![]() |
| Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (2 proteins) |
| Protein D-hydantoinase [75045] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [75047] (1 PDB entry) |
| Domain d1k1db1: 1k1d B:1-52,B:385-460 [71981] Other proteins in same PDB: d1k1da2, d1k1db2, d1k1dc2, d1k1dd2, d1k1de2, d1k1df2, d1k1dg2, d1k1dh2 |
PDB Entry: 1k1d (more details), 3.01 Å
SCOP Domain Sequences for d1k1db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1db1 b.92.1.3 (B:1-52,B:385-460) D-hydantoinase {Bacillus stearothermophilus}
mtkiikngtivtatdtyeahllikdgkiamigqnleekgaevidakgcyvfpXivvgsda
dlvifdpniervisaethhmavdynafegmkvtgepvsvlcrgefvvrdkqfvgkpgygq
ylkrakygt
Timeline for d1k1db1: