Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins) automatically mapped to Pfam PF13147 |
Protein D-hydantoinase [75074] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75076] (1 PDB entry) |
Domain d1k1da2: 1k1d A:53-384 [71980] Other proteins in same PDB: d1k1da1, d1k1db1, d1k1dc1, d1k1dd1, d1k1de1, d1k1df1, d1k1dg1, d1k1dh1 complexed with zn |
PDB Entry: 1k1d (more details), 3.01 Å
SCOPe Domain Sequences for d1k1da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1da2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]} ggidphthldmplggtvtkddfesgtiaaafggtttiidfcltnkgeplkkaietwhnka ngkavidygfhlmiseitddvleelpkvleeegitslkvfmayknvfqaddgtlyctlla akelgalvmvhaengdvidyltkkaladgntdpiyhaltrppelegeatgracqltelag sqlyvvhvtcaqavekiaearnkgldvwgetcpqylvldqsylekpnfegakyvwspplr ekwhqevlwnalkngqlqtlgsdqcsfdfkgqkelgrgdftkipnggpiiedrvsilfse gvkkgritlnqfvdivstriaklfglfpkkgt
Timeline for d1k1da2: