![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Melanoma inhibitory activity protein [63746] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63747] (3 PDB entries) |
![]() | Domain d1k0xa_: 1k0x A: [71977] |
PDB Entry: 1k0x (more details)
SCOPe Domain Sequences for d1k0xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0xa_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} mgpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlf wggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq
Timeline for d1k0xa_: