Lineage for d1k0ta_ (1k0t A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203836Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins)
    has C-terminal extension to the common fold
  6. 1203885Protein Photosystem I iron-sulfur protein PsaC [64272] (2 species)
  7. 1203888Species Synechococcus sp. pcc 7002 [TaxId:32049] [75426] (1 PDB entry)
  8. 1203889Domain d1k0ta_: 1k0t A: [71976]
    complexed with sf4

Details for d1k0ta_

PDB Entry: 1k0t (more details)

PDB Description: nmr solution structure of unbound, oxidized photosystem i subunit psac, containing [4fe-4s] clusters fa and fb
PDB Compounds: (A:) psac subunit of photosystem I

SCOPe Domain Sequences for d1k0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ta_ d.58.1.2 (A:) Photosystem I iron-sulfur protein PsaC {Synechococcus sp. pcc 7002 [TaxId: 32049]}
shsvkiydtcigctqcvracpldvlemvpwdgckagqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay

SCOPe Domain Coordinates for d1k0ta_:

Click to download the PDB-style file with coordinates for d1k0ta_.
(The format of our PDB-style files is described here.)

Timeline for d1k0ta_: