Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (2 proteins) has C-terminal extension to the common fold |
Protein Photosystem I iron-sulfur protein PsaC [64272] (2 species) |
Species Synechococcus sp. pcc 7002 [TaxId:32049] [75426] (1 PDB entry) |
Domain d1k0ta_: 1k0t A: [71976] complexed with sf4 |
PDB Entry: 1k0t (more details)
SCOPe Domain Sequences for d1k0ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ta_ d.58.1.2 (A:) Photosystem I iron-sulfur protein PsaC {Synechococcus sp. pcc 7002 [TaxId: 32049]} shsvkiydtcigctqcvracpldvlemvpwdgckagqiassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d1k0ta_: