Lineage for d1k0ta_ (1k0t A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 191936Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 192003Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
  6. 192018Protein Photosystem I iron-sulfur protein PsaC [64272] (2 species)
  7. 192021Species Synechococcus sp. pcc 7002 [TaxId:32049] [75426] (1 PDB entry)
  8. 192022Domain d1k0ta_: 1k0t A: [71976]

Details for d1k0ta_

PDB Entry: 1k0t (more details)

PDB Description: nmr solution structure of unbound, oxidized photosystem i subunit psac, containing [4fe-4s] clusters fa and fb

SCOP Domain Sequences for d1k0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ta_ d.58.1.4 (A:) Photosystem I iron-sulfur protein PsaC {Synechococcus sp. pcc 7002}
shsvkiydtcigctqcvracpldvlemvpwdgckagqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay

SCOP Domain Coordinates for d1k0ta_:

Click to download the PDB-style file with coordinates for d1k0ta_.
(The format of our PDB-style files is described here.)

Timeline for d1k0ta_: