Lineage for d1k0ha_ (1k0h A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430239Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2430240Superfamily b.106.1: Phage tail proteins [69279] (4 families) (S)
  5. 2430276Family b.106.1.2: gpFII-like [74966] (2 proteins)
    similar to the N-terminal barrel of T4 gp27
    automatically mapped to Pfam PF13856
  6. 2430280Protein Tail attachment protein gpF3 [74967] (1 species)
  7. 2430281Species Bacteriophage lambda [TaxId:10710] [74968] (2 PDB entries)
  8. 2430283Domain d1k0ha_: 1k0h A: [71975]

Details for d1k0ha_

PDB Entry: 1k0h (more details)

PDB Description: solution structure of bacteriophage lambda gpfii
PDB Compounds: (A:) gpFII

SCOPe Domain Sequences for d1k0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ha_ b.106.1.2 (A:) Tail attachment protein gpF3 {Bacteriophage lambda [TaxId: 10710]}
madfdnlfdaaiaradetirgymgtsatitsgeqsgavirgvfddpenisyagqgvrveg
sspslfvrtdevrqlrrgdtltigeenfwvdrvspddggschlwlgrgvppavnrrr

SCOPe Domain Coordinates for d1k0ha_:

Click to download the PDB-style file with coordinates for d1k0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k0ha_: