![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
![]() | Superfamily b.106.1: Phage tail proteins [69279] (2 families) ![]() |
![]() | Family b.106.1.2: Tail attachment protein gpF3 [74966] (1 protein) similar to the N-terminal barrel of T4 gp27 |
![]() | Protein Tail attachment protein gpF3 [74967] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [74968] (1 PDB entry) |
![]() | Domain d1k0ha_: 1k0h A: [71975] |
PDB Entry: 1k0h (more details)
SCOP Domain Sequences for d1k0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ha_ b.106.1.2 (A:) Tail attachment protein gpF3 {Bacteriophage lambda} madfdnlfdaaiaradetirgymgtsatitsgeqsgavirgvfddpenisyagqgvrveg sspslfvrtdevrqlrrgdtltigeenfwvdrvspddggschlwlgrgvppavnrrr
Timeline for d1k0ha_: