Lineage for d1k0fa_ (1k0f A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.92: Chelatase-like [53799] (2 superfamilies) Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) 
Family c.92.2.2: TroA-like [53811] (2 proteins) Protein Periplasmic zinc binding protein TroA [53812] (1 species) Species Treponema pallidum [TaxId:160] [53813] (2 PDB entries) 
Domain d1k0fa_: 1k0f A: [71974]
Details for d1k0fa_
PDB Entry: 1k0f (more details), 2.5 Å
PDB Description: Crystal structure of Zn(II)-free T. pallidum TroA
SCOP Domain Sequences for d1k0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0fa_ c.92.2.2 (A:) Periplasmic zinc binding protein TroA {Treponema pallidum}
gkplvvttigmiadavkniaqgdvhlkglmgpgvdphlytatagdvewlgnadlilyngl
hletkmgevfsklrgsrlvvavsetipvsqrlsleeaefdphvwfdvklwsysvkavyes
lckllpgktreftqryqayqqqldkldayvrrkaqslpaerrvlvtahdafgyfsraygf
evkglqgvstaseasahdmqelaafiaqrklpaifiessiphknvealrdavqarghvvq
iggelfsdamgdagtsegtyvgmvthnidtivaalar
SCOP Domain Coordinates for d1k0fa_:
Click to download the PDB-style file with coordinates for d1k0fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k0fa_:
- d1k0fa_ is new in SCOP 1.61
- d1k0fa_ appears in SCOP 1.63
- d1k0fa_ appears in the current release, SCOPe 2.08
View in 3D