Lineage for d1jyqb1 (1jyq B:60-151)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206615Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2206616Species Human (Homo sapiens) [TaxId:9606] [55564] (35 PDB entries)
  8. 2206643Domain d1jyqb1: 1jyq B:60-151 [71968]
    Other proteins in same PDB: d1jyqa2, d1jyqb2

Details for d1jyqb1

PDB Entry: 1jyq (more details), 2 Å

PDB Description: xray structure of grb2 sh2 domain complexed with a highly affine phospho peptide
PDB Compounds: (B:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1jyqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyqb1 d.93.1.1 (B:60-151) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
wffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagkyf
lwvvkfnslnelvdyhrstsvsrnqqiflrdi

SCOPe Domain Coordinates for d1jyqb1:

Click to download the PDB-style file with coordinates for d1jyqb1.
(The format of our PDB-style files is described here.)

Timeline for d1jyqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jyqb2