| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
| Family d.93.1.1: SH2 domain [55551] (32 proteins) Pfam PF00017 |
| Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries) |
| Domain d1jyqb_: 1jyq B: [71968] complexed with maz, ptm, ptr |
PDB Entry: 1jyq (more details), 2 Å
SCOP Domain Sequences for d1jyqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyqb_ d.93.1.1 (B:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi
Timeline for d1jyqb_: