Lineage for d1jyqa_ (1jyq A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260293Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 260294Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 260295Family d.93.1.1: SH2 domain [55551] (22 proteins)
  6. 260362Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 260363Species Human (Homo sapiens) [TaxId:9606] [55564] (13 PDB entries)
  8. 260369Domain d1jyqa_: 1jyq A: [71967]

Details for d1jyqa_

PDB Entry: 1jyq (more details), 2 Å

PDB Description: xray structure of grb2 sh2 domain complexed with a highly affine phospho peptide
PDB Compounds: (A:)

SCOP Domain Sequences for d1jyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyqa_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
gsmawffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdi

SCOP Domain Coordinates for d1jyqa_:

Click to download the PDB-style file with coordinates for d1jyqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jyqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jyqb_