SCOP 1.73: Domain d1jxvd_: 1jxv D:

Lineage for d1jxvd_ (1jxv D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (3 PDB entries)

8. Domain d1jxvd_: 1jxv D: [71935]

Details for d1jxvd_

PDB Entry: 1jxv, 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A

PDB Compounds: (D:) Nucleoside Diphosphate Kinase A

SCOP Domain Sequences for d1jxvd_:

Sequence; same for both SEQRES and ATOM records:

>d1jxvd_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

Timeline for d1jxvd_:

• d1jxvd_ first appeared in SCOP 1.61
  
• d1jxvd_ appears in SCOP 1.71
  
• d1jxvd_ appears in SCOP 1.75
  
• d1jxvd_ appears in the current release, SCOPe 2.08