SCOPe 2.07: Domain d1jxvc_: 1jxv C:

Lineage for d1jxvc_ (1jxv C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries)

8. Domain d1jxvc_: 1jxv C: [71934]

Details for d1jxvc_

PDB Entry: 1jxv, 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A

PDB Compounds: (C:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d1jxvc_:

Sequence; same for both SEQRES and ATOM records:

>d1jxvc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

Timeline for d1jxvc_:

• d1jxvc_ first appeared in SCOP 1.61
  
• d1jxvc_ appears in SCOPe 2.06
  
• d1jxvc_ appears in the current release, SCOPe 2.08