Lineage for d1jxvc_ (1jxv C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724206Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (3 PDB entries)
  8. 724212Domain d1jxvc_: 1jxv C: [71934]

Details for d1jxvc_

PDB Entry: 1jxv (more details), 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A
PDB Compounds: (C:) Nucleoside Diphosphate Kinase A

SCOP Domain Sequences for d1jxvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxvc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

SCOP Domain Coordinates for d1jxvc_:

Click to download the PDB-style file with coordinates for d1jxvc_.
(The format of our PDB-style files is described here.)

Timeline for d1jxvc_: