Lineage for d1jxvb_ (1jxv B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192178Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 192179Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 192180Protein Nucleoside diphosphate kinases [54921] (8 species)
  7. 192255Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (1 PDB entry)
  8. 192257Domain d1jxvb_: 1jxv B: [71933]

Details for d1jxvb_

PDB Entry: 1jxv (more details), 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A

SCOP Domain Sequences for d1jxvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxvb_ d.58.6.1 (B:) Nucleoside diphosphate kinases {Human (Homo sapiens), NDKA}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

SCOP Domain Coordinates for d1jxvb_:

Click to download the PDB-style file with coordinates for d1jxvb_.
(The format of our PDB-style files is described here.)

Timeline for d1jxvb_: