Lineage for d1jxva_ (1jxv A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257331Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 257332Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 257333Protein Nucleoside diphosphate kinases [54921] (8 species)
  7. 257410Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (1 PDB entry)
  8. 257411Domain d1jxva_: 1jxv A: [71932]

Details for d1jxva_

PDB Entry: 1jxv (more details), 2.2 Å

PDB Description: Crystal Structure of Human Nucleoside Diphosphate Kinase A

SCOP Domain Sequences for d1jxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxva_ d.58.6.1 (A:) Nucleoside diphosphate kinases {Human (Homo sapiens), NDKA}
certfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffag
lvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsv
esaekeiglwfhpeelvdytscaqnwiye

SCOP Domain Coordinates for d1jxva_:

Click to download the PDB-style file with coordinates for d1jxva_.
(The format of our PDB-style files is described here.)

Timeline for d1jxva_: