Lineage for d1jx1f_ (1jx1 F:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191111Fold d.36: Chalcone isomerase [54625] (1 superfamily)
  4. 191112Superfamily d.36.1: Chalcone isomerase [54626] (1 family) (S)
  5. 191113Family d.36.1.1: Chalcone isomerase [54627] (1 protein)
  6. 191114Protein Chalcone isomerase [54628] (1 species)
  7. 191115Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (7 PDB entries)
  8. 191129Domain d1jx1f_: 1jx1 F: [71930]

Details for d1jx1f_

PDB Entry: 1jx1 (more details), 2.3 Å

PDB Description: Chalcone Isomerase--T48A mutant

SCOP Domain Sequences for d1jx1f_:

Sequence, based on SEQRES records: (download)

>d1jx1f_ d.36.1.1 (F:) Chalcone isomerase {Alfalfa (Medicago sativa)}
itaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediavaslaa
kwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgty
gdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavs
savletmigehavspdlkrclaarlpallne

Sequence, based on observed residues (ATOM records): (download)

>d1jx1f_ d.36.1.1 (F:) Chalcone isomerase {Alfalfa (Medicago sativa)}
itaitvenleypavvtspvtgksyflggagerglfikfaaigvylediavaslaakwkgk
sseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygdaea
eamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssavle
tmigehavspdlkrclaarlpallne

SCOP Domain Coordinates for d1jx1f_:

Click to download the PDB-style file with coordinates for d1jx1f_.
(The format of our PDB-style files is described here.)

Timeline for d1jx1f_: