Lineage for d1jx1e_ (1jx1 E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167377Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2167378Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2167379Family d.36.1.1: Chalcone isomerase [54627] (1 protein)
  6. 2167380Protein Chalcone isomerase [54628] (1 species)
  7. 2167381Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (7 PDB entries)
  8. 2167394Domain d1jx1e_: 1jx1 E: [71929]
    complexed with dfv, so4; mutant

Details for d1jx1e_

PDB Entry: 1jx1 (more details), 2.3 Å

PDB Description: Chalcone Isomerase--T48A mutant
PDB Compounds: (E:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d1jx1e_:

Sequence, based on SEQRES records: (download)

>d1jx1e_ d.36.1.1 (E:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
asitaitvenleypavvtspvtgksyflggagergltiegnfikfaaigvylediavasl
aakwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvg
tygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienka
vssavletmigehavspdlkrclaarlpallnegafki

Sequence, based on observed residues (ATOM records): (download)

>d1jx1e_ d.36.1.1 (E:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
asitaitvenleypavvtspvtgksyflggagerglfikfaaigvylediavaslaakwk
gksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgtygda
eaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkavssav
letmigehavspdlkrclaarlpallnegafki

SCOPe Domain Coordinates for d1jx1e_:

Click to download the PDB-style file with coordinates for d1jx1e_.
(The format of our PDB-style files is described here.)

Timeline for d1jx1e_: