Lineage for d1jx0a_ (1jx0 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511324Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2511325Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2511326Family d.36.1.1: Chalcone isomerase [54627] (1 protein)
  6. 2511327Protein Chalcone isomerase [54628] (1 species)
  7. 2511328Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (7 PDB entries)
  8. 2511345Domain d1jx0a_: 1jx0 A: [71923]
    complexed with dfv, so4; mutant

Details for d1jx0a_

PDB Entry: 1jx0 (more details), 2.85 Å

PDB Description: Chalcone Isomerase--Y106F mutant
PDB Compounds: (A:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d1jx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx0a_ d.36.1.1 (A:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
sitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasla
akwkgksseelletldfyrdiisgpfeklirgskirelsgpefsrkvmencvahlksvgt
ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
ssavletmigehavspdlkrclaarlpallnegafki

SCOPe Domain Coordinates for d1jx0a_:

Click to download the PDB-style file with coordinates for d1jx0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jx0a_: