Lineage for d1jwza_ (1jwz A:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517216Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 517217Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 517218Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)
  6. 517302Protein beta-Lactamase, class A [56606] (15 species)
  7. 517317Species Escherichia coli, TEM-1 [TaxId:562] [56607] (28 PDB entries)
  8. 517331Domain d1jwza_: 1jwz A: [71922]
    TEM-64 variant

Details for d1jwza_

PDB Entry: 1jwz (more details), 1.8 Å

PDB Description: crystal structure of tem-64 beta-lactamase in complex with a boronic acid inhibitor (105)

SCOP Domain Sequences for d1jwza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwza_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldswepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1jwza_:

Click to download the PDB-style file with coordinates for d1jwza_.
(The format of our PDB-style files is described here.)

Timeline for d1jwza_: