SCOPe 2.03: Domain d1jwwa_: 1jww A:

Lineage for d1jwwa_ (1jww A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species)
   duplication: contains tandem repeat of two HMA domains in the N-terminal region

7. Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries)

8. Domain d1jwwa_: 1jww A: [71919]
   domain 2

Details for d1jwwa_

PDB Entry: 1jww

PDB Description: nmr characterization of the n-terminal domain of a potential copper- translocating p-type atpase from bacillus subtilis

PDB Compounds: (A:) Potential copper-transporting ATPase

SCOPe Domain Sequences for d1jwwa_:

Sequence; same for both SEQRES and ATOM records:

>d1jwwa_ d.58.17.1 (A:) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
vtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea
vdklgyklklkgeqdsiegr

Timeline for d1jwwa_:

• d1jwwa_ first appeared in SCOP 1.61
  
• d1jwwa_ appears in SCOPe 2.02
  
• d1jwwa_ appears in SCOPe 2.04
  
• d1jwwa_ appears in the current release, SCOPe 2.08