Lineage for d1jwva_ (1jwv A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949540Protein beta-Lactamase, class A [56606] (16 species)
  7. 1949565Species Escherichia coli, TEM-1 [TaxId:562] [56607] (47 PDB entries)
  8. 1949586Domain d1jwva_: 1jwv A: [71918]
    complexed with cb4, k; mutant

Details for d1jwva_

PDB Entry: 1jwv (more details), 1.85 Å

PDB Description: crystal structure of g238a mutant of tem-1 beta-lactamase in complex with a boronic acid inhibitor (sefb4)
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1jwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwva_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgaaergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1jwva_:

Click to download the PDB-style file with coordinates for d1jwva_.
(The format of our PDB-style files is described here.)

Timeline for d1jwva_: