SCOPe 2.06: Domain d1jwhc_: 1jwh C:

Lineage for d1jwhc_ (1jwh C:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family)
   automatically mapped to Pfam PF01214

5. Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
   contains alpha-helices in the N- and C-terminal extensions (linkers?)

6. Protein Casein kinase II beta subunit [57800] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57801] (5 PDB entries)

8. Domain d1jwhc_: 1jwh C: [71915]
   Other proteins in same PDB: d1jwha_, d1jwhb_
   complexed with anp, po4, zn

Details for d1jwhc_

PDB Entry: 1jwh, 3.1 Å

PDB Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme

PDB Compounds: (C:) Casein kinase II beta chain

SCOPe Domain Sequences for d1jwhc_:

Sequence; same for both SEQRES and ATOM records:

>d1jwhc_ g.41.4.1 (C:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn
pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls
dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvp
rlygfkihpmayqlqlqaas

Timeline for d1jwhc_:

• d1jwhc_ first appeared in SCOP 1.61
  
• d1jwhc_ appears in SCOPe 2.05
  
• d1jwhc_ appears in SCOPe 2.07
  
• d1jwhc_ appears in the current release, SCOPe 2.08