Lineage for d1jwhc_ (1jwh C:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893087Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
  5. 893088Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 893089Protein Casein kinase II beta subunit [57800] (3 species)
  7. 893099Species Human (Homo sapiens) [TaxId:9606] [57801] (3 PDB entries)
  8. 893104Domain d1jwhc_: 1jwh C: [71915]
    Other proteins in same PDB: d1jwha_, d1jwhb_

Details for d1jwhc_

PDB Entry: 1jwh (more details), 3.1 Å

PDB Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme
PDB Compounds: (C:) Casein kinase II beta chain

SCOP Domain Sequences for d1jwhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwhc_ g.41.4.1 (C:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn
pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls
dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvp
rlygfkihpmayqlqlqaas

SCOP Domain Coordinates for d1jwhc_:

Click to download the PDB-style file with coordinates for d1jwhc_.
(The format of our PDB-style files is described here.)

Timeline for d1jwhc_: