Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) |
Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein) contains alpha-helices in the N- and C-terminal extensions (linkers?) |
Protein Casein kinase II beta subunit [57800] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57801] (3 PDB entries) |
Domain d1jwhc_: 1jwh C: [71915] Other proteins in same PDB: d1jwha_, d1jwhb_ |
PDB Entry: 1jwh (more details), 3.1 Å
SCOP Domain Sequences for d1jwhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwhc_ g.41.4.1 (C:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]} evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvp rlygfkihpmayqlqlqaas
Timeline for d1jwhc_: